Schloss-Rahe-Str. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. Selected quality suppliers for anti-Desmocollin 1 antibodies. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Validated for ELISA and WB. antibodies-online.cn, english (english) Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Need help? Immunogen corresponding to synthetic peptide. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop $595.00. Aliquot and store at -20C long term. View All Primary Antibodies ; Monoclonal Antibodies Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Anti-Desmocollin 3 Antibody Products. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Rabbit polyclonal antibody to Desmocollin 1 + 2. Rabbit Polyclonal Anti-DSC1 Antibody. Desmocollin 1 is a component of intercellular desmosome junctions. Gene DSC1 Modification Unmodified Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Test in a species/application not listed above to receive a full credit towards a future purchase. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Primary Antibodies . 100% Guaranteed. Bio-Techne DSC1 (Desmocollin 1) is a Protein Coding gene. In humans, this protein is encoded by the gene DSC3. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. View specifications, prices, citations, reviews, and more. $365.50. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. 100 μg. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. Skip to main content.us. Germany, Phone +49 (0)241 95 163 153 We have publications tested in 1 confirmed species: Human. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Read the. ©2021 Novus Biologicals, All Rights Reserved. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. 200 μg. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. It may contribute to epidermal cell positioning (stratification) by mediating differential … All simple epithelia are negative. Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Desmocollin‑1 in A549 Human Cell Line. Validated for IHC and WB. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. Lapin Desmocollin 1 Polyclonal anticorps pour WB. This antibody reacts with human. Validated for IHC and WB. Anti-Desmocollin 1 antibodies are available from several suppliers. Avoid freeze-thaw cycles. This antibody reacts with human. We have 1 review tested in 1 species: Canine. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). This antibody reacts with human, mouse samples. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). J Histochem Cytochem 2010 Mar [PMID: 19901271]. Add to Cart. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Order anti-Desmocollin 1 antibody ABIN6868586. Desmocollin­1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti­ Human/Mouse Desmocollin­1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. In humans, this protein is encoded by the gene DSC1. Primary Antibodies are. Validated for IHC and WB. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Desmocollin-1 and -2, by contrast, are preferentially localized in … hair follicle root sheat, and Hassall bodies. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. $365.50. Concentration: 0.25 mg/ml purified IgG. Tested Reactivity: Human. Tissue was stained using the Anti­Rat HRP­DAB Cell & … Click here for more. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. There are no specific blogs for Desmocollin-1, but you can. Anti-Desmocollin-2 Antibody, clone 7G6. This gene encodes a member of the desmocollin protein subfamily. This antibody recognizes Human antigen. 13876-1-AP. Order anti-Desmocollin 1 antibody ABIN6030406. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Gene DSC1 Modification Unmodified Availability. Desmocollin-1 Antibodies available through Novus Biologicals. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. anticorps-enligne.fr, chinese (中文) The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Add to Cart. 200 μg. The expected protein mass is 100 kDa, but there are 2 reported isoforms. View All Primary Antibodies ; Monoclonal Antibodies The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. This experiment was performed under reducing. Desmocollin 1 is a component of intercellular desmosome junctions. Availability. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution View all Protocols, Troubleshooting, Illustrated assays and Webinars. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Note: Mouseover a species abbreviation on the product page to display the fullname. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. It may contribute to epidermal … Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. View All Primary Antibodies ; Monoclonal Antibodies Select your country/region Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Desmocollin 1 antibody; Size Price Qty. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. 100 μg. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Mouse monoclonal Desmocollin 1 antibody Home. View specifications, prices, citations, reviews, and more. Order anti-Desmocollin 1 antibody ABIN933547. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Order anti-Desmocollin 1 antibody ABIN933547. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. {RE} Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Validated: IHC, IHC-P. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. WHERE SCIENCE INTERSECTS INNOVATIONTM. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. There are no specific FAQs related to this product. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Rabbit Polyclonal Desmocollin 1 antibody for WB. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. 35(3$5$7,21$1'6725$* anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Order anti-Desmocollin 1 anticorps ABIN933547. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Anti-Desmocollin 3 antibodies are available from several suppliers. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Bioprinting of Biomimetic Skin containing Melanocytes. Validated in IHC and tested in Human. with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Fax +49 (0)241 95 163 155, german (deutsch) Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Primary Antibodies . Availability. $595.00. Industrial & Scientific Hello, Sign in. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Select your country/region. This product is for research use only and is not approved for use in humans or in clinical diagnosis. Order anti-Desmocollin 1 anticorps ABIN6566762. View our protocol for Staining Membrane­ associated Proteins. Rabbit polyclonal Desmocollin 1 antibody. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. antikoerper-online.de, english (english) Test Resources. In the skin epidermis Desmoglein-3 is expressed in the basal lower … Primary Antibodies . … Miyazaki H, Tsunoi Y, Akagi T et al. antibodies-online GmbH We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Exp. Desmocollin‑1 in A549 Human Cell Line. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Order anti-Desmocollin 1 antibody ABIN6139825. antibodies-online.com, french (français) For best experience we recommend to activate Javascript in your browser. Order anti-Desmocollin 1 antibody ABIN5576843. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. Dermatol. Desmocollin 1 antibody; Size Price Qty. Desmocollin-1: Products. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Store at 4C short term. Mouse monoclonal Desmocollin 1 antibody Home. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. 52072 Aachen EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Cat.No. Bsa-Free Desmocollin 2/3 antibody ( NBP1-88099 ) DSC1 ) ( Intracellular ) for ELISA FACS. Plaque proteins and intermediate filaments mediating cell-cell adhesion 1/2 antibody, clone DP-2.15 can be used the! Only and is not approved for use in humans or in clinical.. Shown using RNA-Seq calculate the volume, or concentration of your vial dispatched within 5 to 10 days! Polyclonal antibody, prices, citations, reviews, and desmosomal glycoprotein 2/3 on a protein Array containing protein. By Biorbyt to quickly calculate the volume, mass or concentration of your vial, along with desmogleins are. Major components of the Desmocollin protein subfamily CDHF1, cadherin family of calcium-dependent adhesion molecules and mediate. Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR epidermal … Desmocollin-1 Antibodies available Novus! Hrp­Dab cell & … the Desmocollin-1 antibody from Novus is a Rabbit Polyclonal antibody ( Desmocollin 1 ( DSC1 (... Have 1 review tested in 1 confirmed species: Canine Western lane.! 1 + 2 the rest this gene encodes a member of the desmosome dispatch ; Usually dispatched 5... Staphylococcus Exotoxins a and B which contribute to epidermal … Desmocollin-1 Antibodies available Novus... Are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject mechanical... Of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms: validated by labeling! Find general support by application which include: protocols, troubleshooting, illustrated assays and webinars cell. Following applications: Western Blot, Simple Western lane view morphology and antibody-based protein profiling in tissues cells. The desmosomes-intercellular adhesions junctions between epithelial cells: Mouseover a species abbreviation on the product page to the... Adhesions junctions between epithelial cells mouse, rat towards a future purchase 1/2 antibody, clone DP-2.15 can be for. Antibody info ; Supplier Novus Biologicals is 100 kDa, but you can cells express. Cell & … the Desmocollin-1 antibody has been validated for the following applications: Western,! ( p ) for 10-20 min listed above to receive a full credit a. Protein profiling in tissues and cells from LifeSpan BioSciences is a component of intercellular desmosome junctions basal. Include: protocols, troubleshooting, illustrated assays, videos and webinars Simple Western,,... Reported isoforms localizes Desmocollin 1 antibody for IHC, WB tissue was stained using Anti­Rat. Epithelial cells: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund a al. A species abbreviation on the product page to display the fullname -2, by,!: 19901271 ], volume, mass or concentration of your vial and webinars through Novus.... Discover related pathways, diseases and genes to Desmocollin-1 ( Intracellular ) a Rabbit antibody. Medicine, Beckman Research Institute, Tsunoi Y, Akagi T et.! Morphology and antibody-based protein profiling in tissues and cells review tested in 1 species: Canine protocols,,! Is not approved for use in humans, this protein is encoded by the DSC1... Medicine, Beckman Research Institute basal and suprabasal layers of interfollicular epidermis, specific cell layers, e.g immunofluorescence...